Loading...
Statistics
Advertisement

Roma Hotel
www.romahotel.it/
RomaHotel.it - Guida turistica e Hotel di Roma. Oltre 1100 Hotel a Roma che puoi prenotare online. Servizio di assistenza e prenotazione Hotel a Roma ...

Romahotel.it

Advertisement
Romahotel.it is hosted in Italy / Arezzo . Romahotel.it doesn't use HTTPS protocol. Number of used technologies: 5. First technologies: AJAX Libraries API, CSS, Html, Number of used javascripts: 5. First javascripts: Corner.js, Jquery-1.2.2.pack.js, Jquery.min.js, Number of used analytics tools: 0. Its server type is: Apache/2.2.15 (CentOS).

Technologies in use by Romahotel.it

Technology

Number of occurences: 5
  • AJAX Libraries API
  • CSS
  • Html
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 5
  • corner.js
  • jquery-1.2.2.pack.js
  • jquery.min.js
  • show_ads.js

Advertise

Number of occurences: 1
  • Google Adsense

Server Type

  • Apache/2.2.15 (CentOS)

Social

Number of occurences: 1
  • Google +1 Button

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Romahotel.it

Missing HTTPS protocol.

    Meta - Romahotel.it

    Number of occurences: 4
    • Name:
      Content: text/html; charset=utf-8
    • Name: Description
      Content: RomaHotel.it - Guida turistica e Hotel di Roma. Oltre 1100 Hotel a Roma che puoi prenotare online. Servizio di assistenza e prenotazione Hotel a Roma: inoltre Mappa della Città di Roma, Cosa Vedere, Itinerari, Musei e Attrazioni Turistiche di Roma
    • Name: Keywords
      Content: Roma Hotel, Hotel a Roma, Roma, Hotel Roma, Hotel di Roma, Turismo a Roma, Roma Cittè, Roma Alberghi, Musei a Roma, Albergo a Roma
    • Name: author
      Content: RomaHotel.it

    Server / Hosting

    • IP: 46.37.17.210
    • Latitude: 43.42
    • Longitude: 11.88
    • Country: Italy
    • City: Arezzo

    Rname

    • dns.tuonomeregistrar.net
    • dns2.tuonomeregistrar.net
    • mail.romahotel.it

    Target

    • admin.tuonomeregistrar.net

    HTTP Header Response

    HTTP/1.1 200 OK Date: Tue, 14 Jun 2016 19:23:16 GMT Server: Apache/2.2.15 (CentOS) Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_xt50 X-Cache-Lookup: MISS from s_xt50:80 Via: 1.1 s_xt50 (squid/3.5.14) Connection: keep-alive

    DNS

    host: romahotel.it
    1. class: IN
    2. ttl: 86400
    3. type: A
    4. ip: 46.37.17.210
    host: romahotel.it
    1. class: IN
    2. ttl: 864000
    3. type: NS
    4. target: dns.tuonomeregistrar.net
    host: romahotel.it
    1. class: IN
    2. ttl: 864000
    3. type: NS
    4. target: dns2.tuonomeregistrar.net
    host: romahotel.it
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: dns.tuonomeregistrar.net
    5. rname: admin.tuonomeregistrar.net
    6. serial: 2015011703
    7. refresh: 86400
    8. retry: 7200
    9. expire: 2592000
    10. minimum-ttl: 900
    host: romahotel.it
    1. class: IN
    2. ttl: 864000
    3. type: MX
    4. pri: 10
    5. target: mail.romahotel.it

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.omahotel.it, www.riomahotel.it, www.iomahotel.it, www.roomahotel.it, www.oomahotel.it, www.rlomahotel.it, www.lomahotel.it, www.rlomahotel.it, www.lomahotel.it, www.r.omahotel.it, www..omahotel.it, www.rmahotel.it, www.robmahotel.it, www.rbmahotel.it, www.rohmahotel.it, www.rhmahotel.it, www.rogmahotel.it, www.rgmahotel.it, www.rojmahotel.it, www.rjmahotel.it, www.rommahotel.it, www.rmmahotel.it, www.ro mahotel.it, www.r mahotel.it, www.rovmahotel.it, www.rvmahotel.it, www.roahotel.it, www.rompahotel.it, www.ropahotel.it, www.romoahotel.it, www.rooahotel.it, www.romiahotel.it, www.roiahotel.it, www.romkahotel.it, www.rokahotel.it, www.rom.ahotel.it, www.ro.ahotel.it, www.romuahotel.it, www.rouahotel.it, www.romjahotel.it, www.rojahotel.it, www.romnahotel.it, www.ronahotel.it, www.rom-ahotel.it, www.ro-ahotel.it, www.romhotel.it, www.romaohotel.it, www.romohotel.it, www.romaphotel.it, www.romphotel.it, www.roma9hotel.it, www.rom9hotel.it, www.romahotel.it, www.romhotel.it, www.romaihotel.it, www.romihotel.it, www.romauhotel.it, www.romuhotel.it, www.romaotel.it, www.romaheotel.it, www.romaeotel.it, www.romahdotel.it, www.romadotel.it, www.romahcotel.it, www.romacotel.it, www.romahuotel.it, www.romauotel.it, www.romahjotel.it, www.romajotel.it, www.romahotel.it, www.romaotel.it, www.romahbotel.it, www.romabotel.it, www.romahgotel.it, www.romagotel.it, www.romahtel.it, www.romahobtel.it, www.romahbtel.it, www.romahohtel.it, www.romahhtel.it, www.romahogtel.it, www.romahgtel.it, www.romahojtel.it, www.romahjtel.it, www.romahomtel.it, www.romahmtel.it, www.romaho tel.it, www.romah tel.it, www.romahovtel.it, www.romahvtel.it, www.romahoel.it, www.romahotqel.it, www.romahoqel.it, www.romahotael.it, www.romahoael.it, www.romahot el.it, www.romaho el.it, www.romahotwel.it, www.romahowel.it, www.romahoteel.it, www.romahoeel.it, www.romahotzel.it, www.romahozel.it, www.romahotxel.it, www.romahoxel.it, www.romahotcel.it, www.romahocel.it, www.romahotl.it, www.romahotexl.it, www.romahotxl.it, www.romahotesl.it, www.romahotsl.it, www.romahotewl.it, www.romahotwl.it, www.romahoterl.it, www.romahotrl.it, www.romahotefl.it, www.romahotfl.it, www.romahotevl.it, www.romahotvl.it, www.romahotecl.it, www.romahotcl.it, www.romahoteql.it, www.romahotql.it, www.romahoteal.it, www.romahotal.it, www.romahoteyl.it, www.romahotyl.it, www.romahote.it, www.romahotelu.it, www.romahoteu.it, www.romahotel8.it, www.romahote8.it, www.romahotel9.it, www.romahote9.it, www.romahotelj.it, www.romahotej.it, www.romahotel0.it, www.romahote0.it, www.romahotelm.it, www.romahotem.it, www.romahotelp.it, www.romahotep.it, www.romahotelo.it, www.romahoteo.it,

    Other websites we recently analyzed

    1. 35789.kim
      China - 124.16.31.156
      Server software: Tengine/1.4.2
      Technology: CloudFront, Google Adsense, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1
    2. calvarychapelmerrimackvalley.com at Directnic
      Cayman Islands - 74.117.222.18
      Server software: nginx/1.5.0
      Technology: Html, Javascript
      Number of Javascript: 1
    3. Massachusetts Society of Mayflower Descendants - HOME
      The Mission of the Massachusetts Society of Mayflower Descendants is to gather together to honor and perpetuate the memory of our Mayflower Ancestors and the ideals of American freedoms and democracy, which have evolved from The Mayflower Compact signed by the Pilgrim Fathers when they reached Cape Cod shores in November, 1620.
      Provo (United States) - 67.20.65.25
      Server software: nginx/1.10.1
      Technology: PayPal, CSS, Html, Javascript, Php, Joomla, Add This
      Number of Javascript: 15
      Number of meta tags: 5
    4. 55517.date - Diese Website steht zum Verkauf! - Informationen zum Thema 55517.
      Diese Website steht zum Verkauf! 55517.date ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf 55517.date alles. Wir hoffen, dass Sie hier das Gesuchte finden!
      Cambridge (United States) - 72.52.4.90
      Server software: Apache/2.2.22 (Debian)
      Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
      Number of Javascript: 4
      Number of meta tags: 5
    5. thebeautylotion.com
      Scottsdale (United States) - 50.63.202.48
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    6. giftgiffy.com
      Scottsdale (United States) - 184.168.221.62
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    7. seopill.com - Diese Website steht zum Verkauf! - Informationen zum Thema seopill.
      Diese
      Cambridge (United States) - 72.52.4.119
      Server software: Apache/2.2.22 (Debian)
      Technology: Google Adsense, Html, Html5, Javascript, Php, SVG
      Number of Javascript: 3
      Number of meta tags: 5
    8. tbmall.biz
      Osaka (Japan) - 219.94.155.247
      Server software: Apache/2.2.31
      Technology: Html
      Number of meta tags: 1
    9. Free business profile for GSMARKETING.US provided by Network Solutions
      Learn about GSMARKETING.US from this free business profile provided by Network Solutions
      Jacksonville (United States) - 205.178.189.129
      Server software: Sun-ONE-Web-Server/6.1
      Technology: CSS, Html, Php
      Number of meta tags: 3
    10. ffvainsurance.com
      United States - 208.91.197.27
      Server software: Apache
      Technology: Html
      Number of meta tags: 2

    Check Other Websites